PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araip.EEF42
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family Trihelix
Protein Properties Length: 660aa    MW: 76264.4 Da    PI: 6.6379
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araip.EEF42genomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix39.21.8e-12163228270
     trihelix   2 WtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekk 70 
                  W+++ev aL+++r+ m+++   +    + W++vs+k+ e gf++s  +Ckek+e+  +++ + +++++ 
  Araip.EEF42 163 WSNDEVVALLRIRSTMDTTWFPQ---LTYWDHVSRKLGELGFKKSGDKCKEKFEDETRYFNNYAKNNSY 228
                  *****************998776...89********************************999988865 PP

2trihelix89.92.9e-28512603186
     trihelix   1 rWtkqevlaLiearr.......emeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqle 86 
                  rW+++evlaLi++r        + eer + ++ k plWe++s+ m++ g++rs+k+Ckekwen+nk+++k+k+ +kkr s +s+tcpyf+ql+
  Araip.EEF42 512 RWPRDEVLALINLRCesikmnnNAEERESGNNNKIPLWERISQGMSDLGYKRSAKRCKEKWENINKYFRKTKDVNKKR-SIDSRTCPYFHQLK 603
                  8*************977744333333333357999******************************************8.78889*******97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500906.017155216IPR017877Myb-like domain
SMARTSM0071710159218IPR001005SANT/Myb domain
PfamPF138372.3E-8162226No hitNo description
PROSITE profilePS500906.365505576IPR017877Myb-like domain
SMARTSM007171.2509578IPR001005SANT/Myb domain
PfamPF138372.5E-19511605No hitNo description
CDDcd122034.86E-24511583No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0001158Molecular Functionenhancer sequence-specific DNA binding
GO:0005516Molecular Functioncalmodulin binding
Sequence ? help Back to Top
Protein Sequence    Length: 660 aa     Download sequence    Send to blast
LVACLACSIN LLIYSERRKK ERKKERKKKD RTREVNKFRD NTQNMFDGLP SSSEHFHQFI  60
TPRTTTSTTL PLPHHHHHHH HLSPSSSSSS SSFSPLLHHH ASLTPINTNT FLPFDPYNPH  120
HHQQQPNPTF SSVLNNNNLF HTSATDERVQ TQVLPNDLID SSWSNDEVVA LLRIRSTMDT  180
TWFPQLTYWD HVSRKLGELG FKKSGDKCKE KFEDETRYFN NYAKNNSYRF LNELEEFYQG  240
DNHNENPMVD NQDHVVTEKT QEFEHPINAG GGDIEEVEEE EEEEEEEEES SRDGKSVKEQ  300
CEEDNDSEKK MKMKRKRKRR CRFEMLKGFC ESIVNNMMAQ QEEIHNKLIQ DMLRRDEEKL  360
QREEAWKKQE TERMNKELQI MAQEQAIAGD RQASIIEFLK KYAATQTLTT NPNNDEPTPS  420
SSKLIIPSSH QIQNSSGLCS IPPLSAENPS SMSDTLLQQV HSSSTHSSPA SHNNTTSSSS  480
LNRHDNYHSN SISTMLVKPL VTDQKENNVG RRWPRDEVLA LINLRCESIK MNNNAEERES  540
GNNNKIPLWE RISQGMSDLG YKRSAKRCKE KWENINKYFR KTKDVNKKRS IDSRTCPYFH  600
QLKSLYDEGK LVHQPETTTP ENHSGQLLPP IESSDHVGSG GGFSDDHEKT LIQEPPLNFG
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
11624RRKKERKKE
21826KKERKKERK
3308318KKMKMKRKRKR
4313319KRKRKRR
5314319RKRKRR
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00011PBMTransfer from AT5G28300Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150383e-54AP015038.1 Vigna angularis var. angularis DNA, chromosome 5, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016205443.10.0PREDICTED: trihelix transcription factor GTL2-like
TrEMBLA0A0B2SG001e-160A0A0B2SG00_GLYSO; Trihelix transcription factor GTL2
TrEMBLI1NC801e-160I1NC80_SOYBN; Uncharacterized protein
STRINGGLYMA19G43280.11e-159(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF50433355
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G28300.14e-84Trihelix family protein